PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G358900.1.p
Common NameSb01g034270, SORBIDRAFT_01g034270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 331aa    MW: 35767.3 Da    PI: 6.4247
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G358900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEde+l + ++q+G g+W+++++  g+ R++k+c++rw +yl
  Sobic.001G358900.1.p 14 RGLWSPEEDEKLMNHIAQYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                          788*******************************************97 PP

2Myb_DNA-binding52.98.2e-1767111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Sobic.001G358900.1.p  67 RGTFSQEEEDLIIHLHSLLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                           899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.794961IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001678.12E-121761No hitNo description
PROSITE profilePS5129426.562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2665116IPR009057Homeodomain-like
SMARTSM007175.0E-1666114IPR001005SANT/Myb domain
PfamPF002499.8E-1667111IPR001005SANT/Myb domain
CDDcd001671.95E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA QYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSLLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKRLRERG  120
IDPATHQPLA EPAAATAPAS TTTVSRRAVF GDVDLIPTTT PIQAPSSFEG PMLDGVTKLP  180
AVDMDWPVPG DGVPSSSLPR PCYLQGGCFD IGALQQQQHC GSIVPAPVVP SASSSSTLTS  240
MAEAEHCNTN ITGGSLPWLE LGANAVADAG HVDSCYAGAL DELRWSEYFD SAFQAAASQQ  300
GALQAAGQCV YGGKDDVPVH FDVHGLSNWC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28121165108B-MYB
1h8a_C1e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365350.0BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410770.0BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465218.10.0hypothetical protein SORBIDRAFT_01g034270
TrEMBLC5WYP10.0C5WYP1_SORBI; Putative uncharacterized protein Sb01g034270
STRINGSb01g034270.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-74myb domain protein 50